PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo2G0036500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 323aa    MW: 34685 Da    PI: 8.2977
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo2G0036500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding50.16.3e-161360148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+ ++ + G g+W++ + + g+ R++k+c++rw +yl
   Spipo2G0036500 13 KGPWTPEEDQKLLAYIDRNGHGSWRALPGRAGLQRCGKSCRLRWTNYL 60
                     79********************************************97 PP

2Myb_DNA-binding50.54.6e-1666111148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ +++++++lG++ W++Ia +++ +Rt++++k++w+++l
   Spipo2G0036500  66 RGKFSLQEEQTIIQLHALLGNR-WSAIALHLP-KRTDNEIKNFWNTHL 111
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.7E-23663IPR009057Homeodomain-like
PROSITE profilePS5129416.261860IPR017930Myb domain
SuperFamilySSF466892.32E-2810107IPR009057Homeodomain-like
SMARTSM007172.1E-111262IPR001005SANT/Myb domain
PfamPF002499.9E-151360IPR001005SANT/Myb domain
CDDcd001671.46E-91560No hitNo description
PROSITE profilePS5129425.05461115IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.8E-2564115IPR009057Homeodomain-like
SMARTSM007174.6E-1665113IPR001005SANT/Myb domain
PfamPF002491.9E-1566111IPR001005SANT/Myb domain
CDDcd001675.29E-1268111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000902Biological Processcell morphogenesis
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 323 aa     Download sequence    Send to blast
MGRSPCCEEG LKKGPWTPEE DQKLLAYIDR NGHGSWRALP GRAGLQRCGK SCRLRWTNYL  60
RPDIKRGKFS LQEEQTIIQL HALLGNRWSA IALHLPKRTD NEIKNFWNTH LKKRLAKMGI  120
DPVTHKPSSD AVSTIGGGAA TAAAATLSHM AQWESARLEA EARLARESKM LRPSAGAAAA  180
HFQSSTGAAL STSMPIHLQS SSSCPLPTPC LDLESPTSTL TFSEKTESIV RGTAFSDGLA  240
WPVEQLRIGS FSASAGAAVG SLGDGFVEML LGDSDRFPAG DCTEFTGHGR ANGYNDEESK  300
SYWTNILNLV NSASPSNSPA GF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-25111155108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006659430.11e-116PREDICTED: myb-related protein 308
TrEMBLJ3MT871e-116J3MT87_ORYBR; Uncharacterized protein
STRINGOB08G23170.11e-115(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP56093758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.15e-96myb domain protein 16